McDonnell Genome Institute

Washington University

Transcript

lnc-RARRES1-2:1

Chromosome

chr3

Gene Name

lnc-RARRES1-2

Start

158780647

CPC Label

noncoding

End

158792886

Cancer

OSCC

Strand

-

Peptide

LWEPSPPR

Modified Peptide

n[145]LWEPSPPR

Peptide Length

8

ORF Length

36

Open Reading Frame (ORF)

LWEPSPPREEKEEEDFRSKMTQEEQRQGESPCSQDM

Conservation Score

0.014

PhyloCSF Frame 1

-3.816

No. of Spectra

2

CPC Coding Probability

0.0175995

PhyloCSF Frame 2 

-5.158

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

-5.81

CNTI Score

-0.379636244