McDonnell Genome Institute

Washington University

Transcript

lnc-RARA-2:1

Chromosome

chr17

Gene Name

lnc-RARA-2

Start

40367951

CPC Label

noncoding

End

40368438

Cancer

CCRC

Strand

+

Peptide

IIPGYMCQGGGFTR

Modified Peptide

n[230]IIPGYMCQGGGFTR

Peptide Length

14

ORF Length

126

Open Reading Frame (ORF)

MFFNIAAGSEPLGCVAFELFADKFPKTAENFGALSTGEKGFGYKSSCFHRIIPGYMCQGGGFTRHNGTGGKSICREKSDDENFFLKHTVLASCPWQMLDPTQTVPSFLSALPRLSGWMARVWSLAR

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.221061

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9386

PhyloCSF Frame 3

0

CNTI Score

-0.325818144