McDonnell Genome Institute

Washington University

Transcript

lnc-RAPSN-2:1

Chromosome

chr11

Gene Name

lnc-RAPSN-2

Start

47466431

CPC Label

noncoding

End

47469504

Cancer

OV

Strand

-

Peptide

LFIVVPK

Modified Peptide

n[145]LFIVVPK

Peptide Length

7

ORF Length

67

Open Reading Frame (ORF)

LFSLSLFGCIALCNSVGLPLSGLFFFLDSCRLFIVVPKACRCGVKYIVQIPVSSASLMLELSPLTLC

Conservation Score

1

PhyloCSF Frame 1

-0.784

No. of Spectra

1

CPC Coding Probability

0.1675

PhyloCSF Frame 2 

4.08

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

6.608

CNTI Score

-0.353708915