McDonnell Genome Institute

Washington University

Transcript

lnc-RAPH1-6:1

Chromosome

chr2

Gene Name

lnc-RAPH1-6

Start

203237460

CPC Label

noncoding

End

203239971

Cancer

OV

Strand

-

Peptide

LTEASGERRTGGSQR

Modified Peptide

n[145]LTEASGERRTGGSQR

Peptide Length

15

ORF Length

146

Open Reading Frame (ORF)

LTEASGERRTGGSQRRQRQRKPRTRTRSAALSPKKHLPGAPKRSKTWTSSTLDSSQDRSMDRWKRGIHKCWENPQERRKEWRAQESRPDTLGNEIWVWRVMAKKLPKVLESRLGEWRGVPGKVRPACGGAGFSSAALRPPGPAPEG

Conservation Score

0.17

PhyloCSF Frame 1

-3.051

No. of Spectra

1

CPC Coding Probability

0.0866552

PhyloCSF Frame 2 

1.023

CNTI Index

coding

Max Probability

0.5302

PhyloCSF Frame 3

-2.229

CNTI Score

0.73398446