McDonnell Genome Institute

Washington University

Transcript

lnc-RAPH1-3:1

Chromosome

chr2

Gene Name

lnc-RAPH1-3

Start

204470075

CPC Label

noncoding

End

204473837

Cancer

OSCC

Strand

-

Peptide

SIISTSDAR

Modified Peptide

n[145]SIISTSDAR

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

LKEAKSLTIALSIANEVLRGTMFYDARGRKSIISTSDARGRNSQL

Conservation Score

1

PhyloCSF Frame 1

-4.918

No. of Spectra

5

CPC Coding Probability

0.0151119

PhyloCSF Frame 2 

-1.387

CNTI Index

noncoding

Max Probability

0.9949

PhyloCSF Frame 3

-3.147

CNTI Score

-0.419709353