McDonnell Genome Institute

Washington University

Transcript

lnc-RAP1GDS1-6:1

Chromosome

chr4

Gene Name

lnc-RAP1GDS1-6

Start

98048554

CPC Label

coding

End

98049043

Cancer

CCRC

Strand

+

Peptide

KMIGLHSSFMNEFFIHK

Modified Peptide

KMIGLHSSFMNEFFIHK

Peptide Length

17

ORF Length

65

Open Reading Frame (ORF)

LVSYKDYRGNFGDIMFNFGKEKFEVKKMIGLHSSFMNEFFIHKEIFKTWMILKGVQEILVSLEKI

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.720133

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.0645

PhyloCSF Frame 3

0

CNTI Score

-0.356744642