McDonnell Genome Institute

Washington University

Transcript

lnc-RAP1A-1:1

Chromosome

chr1

Gene Name

lnc-RAP1A-1

Start

111541363

CPC Label

noncoding

End

111549321

Cancer

OV

Strand

+

Peptide

LQDLDSACLK

Modified Peptide

n[145]LQDLDSACLK

Peptide Length

10

ORF Length

57

Open Reading Frame (ORF)

MLQDLDSACLKFPLKALLFCAADLGTMVLAPIKWKVCTTLIFRSELGKLNQLRCLWH

Conservation Score

0.404

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0385937

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9939

PhyloCSF Frame 3

0

CNTI Score

-0.374665425