McDonnell Genome Institute

Washington University

Transcript

lnc-RAN-5:1

Chromosome

chr12

Gene Name

lnc-RAN-5

Start

130978811

CPC Label

noncoding

End

130979346

Cancer

OV

Strand

+

Peptide

AGVAGSPFMR

Modified Peptide

n[145]AGVAGSPFM[147]R

Peptide Length

10

ORF Length

74

Open Reading Frame (ORF)

LGVCPGFCTPQRPRQGSGGRLGGLSWLLYPSAPKAGVAGSPFMRWVWVVPARSGDTSVSCPRPLCNPHSRTLLR

Conservation Score

0.908

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0806499

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.6617

PhyloCSF Frame 3

0

CNTI Score

-0.354550152