McDonnell Genome Institute

Washington University

Transcript

lnc-RAN-3:1

Chromosome

chr12

Gene Name

lnc-RAN-3

Start

130760707

CPC Label

noncoding

End

130762464

Cancer

OV

Strand

+

Peptide

AAMFVWR

Modified Peptide

n[145]AAMFVWR

Peptide Length

7

ORF Length

55

Open Reading Frame (ORF)

LERSCRKAAMFVWRFPVRWCGSMRRKHTETKRWNQAVSGHFLPPQLCLECQPQHR

Conservation Score

0.08

PhyloCSF Frame 1

0

No. of Spectra

6

CPC Coding Probability

0.0592122

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.7525

PhyloCSF Frame 3

0

CNTI Score

-0.3750771