McDonnell Genome Institute

Washington University

Transcript

lnc-RALY-1:1

Chromosome

chr20

Gene Name

lnc-RALY-1

Start

34122469

CPC Label

noncoding

End

34123290

Cancer

CCRC

Strand

+

Peptide

ATFDTISK

Modified Peptide

n[230]ATFDTISK

Peptide Length

8

ORF Length

72

Open Reading Frame (ORF)

LPHLSQGLHCHPGNFAKATFDTISKTYSYLTLDLWKETIFTKSPYQEFTDHLVKTHTRVSMQRTQAPAVATA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.194839

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.1634

PhyloCSF Frame 3

0

CNTI Score

-0.278376545