McDonnell Genome Institute

Washington University

Transcript

lnc-RALGDS-2:3

Chromosome

chr9

Gene Name

lnc-RALGDS-2

Start

133025848

CPC Label

noncoding

End

133030449

Cancer

EOGC

Strand

-

Peptide

GGESEFR

Modified Peptide

n[145]GGESEFR

Peptide Length

7

ORF Length

34

Open Reading Frame (ORF)

LKGFMRSSDPIHAFERPLWLLCGEQIKGGESEFR

Conservation Score

0.724

PhyloCSF Frame 1

0

No. of Spectra

27

CPC Coding Probability

0.132573

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9997

PhyloCSF Frame 3

0

CNTI Score

0.65730366