McDonnell Genome Institute

Washington University

Transcript

lnc-RALGAPA2-5:2

Chromosome

chr20

Gene Name

lnc-RALGAPA2-5

Start

20389628

CPC Label

noncoding

End

20391561

Cancer

OSCC

Strand

-

Peptide

FSLGCLSNK

Modified Peptide

n[145]FSLGCLSNK

Peptide Length

9

ORF Length

77

Open Reading Frame (ORF)

LGQNVVRLAGLRQGQASSLTSLHTYSQIPSRAKLMFIVSLYLGFRTLKNYDFLKISLQQTEVKKFSLGCLSNKVCGS

Conservation Score

0.998

PhyloCSF Frame 1

-4.514

No. of Spectra

37

CPC Coding Probability

0.0352108

PhyloCSF Frame 2 

-5.707

CNTI Index

noncoding

Max Probability

0.9983

PhyloCSF Frame 3

-3.857

CNTI Score

-0.371251738