McDonnell Genome Institute

Washington University

Transcript

lnc-RALGAPA2-4:1

Chromosome

chr20

Gene Name

lnc-RALGAPA2-4

Start

20360703

CPC Label

noncoding

End

20368120

Cancer

OV

Strand

-

Peptide

GPGLGGRPVGAADVPEGAGPPR

Modified Peptide

n[145]GPGLGGRPVGAADVPEGAGPPR

Peptide Length

22

ORF Length

136

Open Reading Frame (ORF)

LAGWEGDGAAKRGPGLGGRPVGAADVPEGAGPPRAPLVAPPGAAAPPGPGTRPAPPPFTVCCFSMGRRTCLGFVSLLRGARSRQMGPSISATMHAPLPRGDYPRVASKIATKEKNGPKYVRRVQSASRSRGGSCAR

Conservation Score

1

PhyloCSF Frame 1

6.438

No. of Spectra

1

CPC Coding Probability

0.271183

PhyloCSF Frame 2 

6.405

CNTI Index

coding

Max Probability

0.8199

PhyloCSF Frame 3

-0.081

CNTI Score

0.694145386