McDonnell Genome Institute

Washington University

Transcript

lnc-RALGAPA1-1:2

Chromosome

chr14

Gene Name

lnc-RALGAPA1-1

Start

35816063

CPC Label

noncoding

End

35826736

Cancer

OSCC

Strand

-

Peptide

ELYPGGQEGNIK

Modified Peptide

n[145]ELYPGGQEGNIK

Peptide Length

12

ORF Length

150

Open Reading Frame (ORF)

LHLFVCLFVCLLFFGQSFPLVAQARVQWHHLGSLQPPTPRFKQFSCLRLRSGWDYRRPPPCPANFVVLVEIGFHHVGQAGLELLISGDPPTSASQSAGITGVSHRAQHEHCCMHLFFRHMCENFSRSVSPKWEECIRELYPGGQEGNIKI

Conservation Score

0.984

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0852892

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3641

PhyloCSF Frame 3

0

CNTI Score

-0.28527634