McDonnell Genome Institute

Washington University

Transcript

lnc-RAI2-5:1

Chromosome

chrX

Gene Name

lnc-RAI2-5

Start

17731852

CPC Label

noncoding

End

17737080

Cancer

PRAD

Strand

-

Peptide

IVQPAADTVAAAAGCRR

Modified Peptide

IVQPAADTVAAAAGCRR

Peptide Length

17

ORF Length

50

Open Reading Frame (ORF)

LGGTVVMWAPVRIFRLSLGDCLHGRIVQPAADTVAAAAGCRRGPRTSNPC

Conservation Score

1

PhyloCSF Frame 1

-4.527

No. of Spectra

22

CPC Coding Probability

0.1352

PhyloCSF Frame 2 

15

CNTI Index

noncoding

Max Probability

0.8975

PhyloCSF Frame 3

-4.169

CNTI Score

-0.326518344