McDonnell Genome Institute

Washington University

Transcript

lnc-RAG2-1:4

Chromosome

chr11

Gene Name

lnc-RAG2-1

Start

36575573

CPC Label

noncoding

End

36598232

Cancer

CCRC

Strand

-

Peptide

LVMSFLAK

Modified Peptide

n[230]LVMSFLAK

Peptide Length

8

ORF Length

55

Open Reading Frame (ORF)

LVMSFLAKLPFILMIGLRFIFFRRCLSSVACHLFLSSLEALGFLYTSPISSWKIL

Conservation Score

1

PhyloCSF Frame 1

-3.655

No. of Spectra

1

CPC Coding Probability

0.0304023

PhyloCSF Frame 2 

14.375

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

-3.339

CNTI Score

-0.369371283