McDonnell Genome Institute

Washington University

Transcript

lnc-RADIL-7:1

Chromosome

chr7

Gene Name

lnc-RADIL-7

Start

4639772

CPC Label

coding

End

4641709

Cancer

PRAD

Strand

-

Peptide

LQSGASVGGRGGAVVTWMEGGIGPR

Modified Peptide

LQSGASVGGRGGAVVTWM[147]EGGIGPR

Peptide Length

25

ORF Length

72

Open Reading Frame (ORF)

LLLALRRVHLLRVLAQAGHWPLSPGSRLQSGASVGGRGGAVVTWMEGGIGPRSAPLGSCTQQLRGPLETHQS

Conservation Score

0.028

PhyloCSF Frame 1

0

No. of Spectra

9

CPC Coding Probability

0.62691

PhyloCSF Frame 2 

-1.638

CNTI Index

noncoding

Max Probability

0.9453

PhyloCSF Frame 3

0

CNTI Score

-0.353801065