McDonnell Genome Institute

Washington University

Transcript

lnc-RADIL-5:1

Chromosome

chr7

Gene Name

lnc-RADIL-5

Start

4432965

CPC Label

noncoding

End

4435912

Cancer

BRCA-Basal-like

Strand

-

Peptide

MRFSPSDDFIPLTPPMNSPSSSMILLK

Modified Peptide

n[145]MRFSPSDDFIPLTPPMNSPSSSM[147]ILLK

Peptide Length

27

ORF Length

83

Open Reading Frame (ORF)

LTYQRMRFSPSDDFIPLTPPMNSPSSSMILLKTPEFLREMDLEVSFHLPAWGPAIAKLSVLQILLSQCIGLLLCRGHRNLLVP

Conservation Score

0.709

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.162456

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.864

PhyloCSF Frame 3

0

CNTI Score

0.582509754