McDonnell Genome Institute

Washington University

Transcript

lnc-RADIL-1:1

Chromosome

chr7

Gene Name

lnc-RADIL-1

Start

4767625

CPC Label

noncoding

End

4771443

Cancer

OV

Strand

-

Peptide

NTLDRRHCK

Modified Peptide

n[145]NTLDRRHCK

Peptide Length

9

ORF Length

76

Open Reading Frame (ORF)

LTFPLHRTLLLFKALIIKHVVKNTLDRRHCKKKNTHTHTHTHTHTHTEQHPPLPNYFYRRIIVQIKTTRTKTQYWL

Conservation Score

1

PhyloCSF Frame 1

-2.878

No. of Spectra

20

CPC Coding Probability

0.329182

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.955

PhyloCSF Frame 3

-4.618

CNTI Score

-0.309852312