McDonnell Genome Institute

Washington University

Transcript

lnc-RAD54L2-5:1

Chromosome

chr3

Gene Name

lnc-RAD54L2-5

Start

51500380

CPC Label

noncoding

End

51503207

Cancer

CCRC

Strand

+

Peptide

QLDISGLR

Modified Peptide

n[230]QLDISGLR

Peptide Length

8

ORF Length

53

Open Reading Frame (ORF)

LSHEYKTQQACCYAQARQLDISGLRLTLLCLFHPLLHGVPKKEEAPSERVRSA

Conservation Score

0.898

PhyloCSF Frame 1

-5.66

No. of Spectra

1

CPC Coding Probability

0.0569148

PhyloCSF Frame 2 

-4.72

CNTI Index

noncoding

Max Probability

0.9932

PhyloCSF Frame 3

-4.283

CNTI Score

-0.373480179