McDonnell Genome Institute

Washington University

Transcript

lnc-RAD52-2:3

Chromosome

chr12

Gene Name

lnc-RAD52-2

Start

990054

CPC Label

noncoding

End

991117

Cancer

OV

Strand

-

Peptide

LGSGGNR

Modified Peptide

n[145]LGSGGNR

Peptide Length

7

ORF Length

138

Open Reading Frame (ORF)

LGSGGNRRHGGRLAPKQSDGRGASLHTHTHSHTHTHDPCGHGRGEPGSAPRAQGGACLLLLAVGSGRWKPEEPLRVFPNLSGAPPPTSRGPLRPGQPSAAGAAPGSTLAAGGTLCPKKAGFLPLSFVERGREISGLLT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

5

CPC Coding Probability

0.0211742

PhyloCSF Frame 2 

-2.886

CNTI Index

noncoding

Max Probability

0.9296

PhyloCSF Frame 3

2.415

CNTI Score

-0.322152272