McDonnell Genome Institute

Washington University

Transcript

lnc-RAD51B-6:1

Chromosome

chr14

Gene Name

lnc-RAD51B-6

Start

68795210

CPC Label

noncoding

End

68809156

Cancer

PRAD

Strand

+

Peptide

TPGLGGESSGAQDLFCRR

Modified Peptide

TPGLGGESSGAQDLFCRR

Peptide Length

18

ORF Length

56

Open Reading Frame (ORF)

LADNINPNRESSTVPIPLPRRTPGLGGESSGAQDLFCRRGSACRLWPPPCQLCLNR

Conservation Score

1

PhyloCSF Frame 1

-3.045

No. of Spectra

16

CPC Coding Probability

0.0921198

PhyloCSF Frame 2 

-3.915

CNTI Index

noncoding

Max Probability

0.9894

PhyloCSF Frame 3

-4.153

CNTI Score

-0.36230861