McDonnell Genome Institute

Washington University

Transcript

lnc-RAD51-1:1

Chromosome

chr15

Gene Name

lnc-RAD51-1

Start

40642932

CPC Label

noncoding

End

40646857

Cancer

OV

Strand

+

Peptide

TLPPGLTPFSCLNLYYYR

Modified Peptide

n[145]TLPPGLTPFSCLNLYYYR

Peptide Length

18

ORF Length

54

Open Reading Frame (ORF)

LNWKLLFYFLFLFLRQSLTLSPRRDLGLLRTLPPGLTPFSCLNLYYYRHGGRHL

Conservation Score

0.224

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0160944

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9427

PhyloCSF Frame 3

0

CNTI Score

-0.391387689