McDonnell Genome Institute

Washington University

Transcript

lnc-RAD50-4:1

Chromosome

chr5

Gene Name

lnc-RAD50-4

Start

132491014

CPC Label

noncoding

End

132492815

Cancer

PRAD

Strand

+

Peptide

GGLALIPPSTLASGR

Modified Peptide

‚Äč

Peptide Length

15

ORF Length

79

Open Reading Frame (ORF)

LGLPLAGFREQRRRRGSEKPRRLSEGRGGLALIPPSTLASGRLQSLPVARVWEFRNGSIAVISESPGLGPERFWAAWRN

Conservation Score

0.041

PhyloCSF Frame 1

-3.346

No. of Spectra

8

CPC Coding Probability

0.030257

PhyloCSF Frame 2 

-3.549

CNTI Index

noncoding

Max Probability

0.9854

PhyloCSF Frame 3

-2.657

CNTI Score

-0.28185779