McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-8:3

Chromosome

chr9

Gene Name

lnc-RAD23B-8

Start

107566824

CPC Label

noncoding

End

107576223

Cancer

OV

Strand

+

Peptide

ELMNSIK

Modified Peptide

n[145]ELMNSIK

Peptide Length

7

ORF Length

69

Open Reading Frame (ORF)

LRLRRRSYDSCLIKFADRMKELMNSIKSGKASWRRSTLLQWAEKTFHETRARRGVAWQLKPETDLNLEV

Conservation Score

0.999

PhyloCSF Frame 1

-5.691

No. of Spectra

16

CPC Coding Probability

0.0649369

PhyloCSF Frame 2 

-5.595

CNTI Index

noncoding

Max Probability

0.9536

PhyloCSF Frame 3

-5.709

CNTI Score

-0.373492709