McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-5:7

Chromosome

chr9

Gene Name

lnc-RAD23B-5

Start

107490024

CPC Label

noncoding

End

107493637

Cancer

OV

Strand

+

Peptide

LAGCLCITAAGLK

Modified Peptide

n[145]LAGCLCITAAGLK

Peptide Length

13

ORF Length

65

Open Reading Frame (ORF)

LAGCLCITAAGLKKNSKKKKLFFFFETESHSVAQAGVQWRDLGSLQPPLPGWRWKQFSCLSLQSS

Conservation Score

0.316

PhyloCSF Frame 1

0

No. of Spectra

27

CPC Coding Probability

0.135658

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9982

PhyloCSF Frame 3

0

CNTI Score

-0.277344134