McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-5:6

Chromosome

chr9

Gene Name

lnc-RAD23B-5

Start

107490024

CPC Label

noncoding

End

107491275

Cancer

PRAD

Strand

+

Peptide

AGEERDYPR

Modified Peptide

‚Äč

Peptide Length

9

ORF Length

48

Open Reading Frame (ORF)

LPRCLRAGEERDYPRDSSSPPSPPPSLRSQESALVAQRQCRWRCRRSA

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.114387

PhyloCSF Frame 2 

2.054

CNTI Index

noncoding

Max Probability

0.8385

PhyloCSF Frame 3

0.765

CNTI Score

-0.277344134