McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-19:2

Chromosome

chr9

Gene Name

lnc-RAD23B-19

Start

107638210

CPC Label

noncoding

End

107642215

Cancer

OV

Strand

+

Peptide

INEAMFGKGLSPHQER

Modified Peptide

n[145]INEAMFGKGLSPHQER

Peptide Length

16

ORF Length

35

Open Reading Frame (ORF)

LSSLFLFVSARINEAMFGKGLSPHQERHPRQLFKE

Conservation Score

1

PhyloCSF Frame 1

-5.258

No. of Spectra

1

CPC Coding Probability

0.366999

PhyloCSF Frame 2 

-5.102

CNTI Index

noncoding

Max Probability

0.2725

PhyloCSF Frame 3

-4.622

CNTI Score

-0.367366569