McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-15:1

Chromosome

chr9

Gene Name

lnc-RAD23B-15

Start

107741189

CPC Label

noncoding

End

107742912

Cancer

BRCA-Luminal B

Strand

+

Peptide

GALVDHR

Modified Peptide

n[145]GALVDHR

Peptide Length

7

ORF Length

39

Open Reading Frame (ORF)

MGALVDHRSFSLQRSRVAGCPGWWESLTSPVLEMNRASS

Conservation Score

0.565

PhyloCSF Frame 1

-5.555

No. of Spectra

37

CPC Coding Probability

0.0219947

PhyloCSF Frame 2 

-4.819

CNTI Index

noncoding

Max Probability

0.9858

PhyloCSF Frame 3

-3.597

CNTI Score

-0.428591434