McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-13:1

Chromosome

chr9

Gene Name

lnc-RAD23B-13

Start

107534389

CPC Label

noncoding

End

107535162

Cancer

EOGC

Strand

+

Peptide

GDGHVGPICTICQSISK

Modified Peptide

n[145]GDGHVGPICTICQSISK

Peptide Length

17

ORF Length

53

Open Reading Frame (ORF)

MGDGHVGPICTICQSISKALVACCQKYKKYVDEASKKEIKDILIQYDMYPSGS

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.054173

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.8474

PhyloCSF Frame 3

0

CNTI Score

-0.342913389