McDonnell Genome Institute

Washington University

Transcript

lnc-RAD23B-11:1

Chromosome

chr9

Gene Name

lnc-RAD23B-11

Start

107999567

CPC Label

noncoding

End

108007385

Cancer

OV

Strand

+

Peptide

EDLQHSLR

Modified Peptide

n[145]EDLQHSLR

Peptide Length

8

ORF Length

69

Open Reading Frame (ORF)

MVITVHIVMQQVWNLQPTPRSSDKFLLLPACNPRQVIFLLCISISLPETSREDLQHSLRLYTSCSPGTR

Conservation Score

0.134

PhyloCSF Frame 1

-3.129

No. of Spectra

2

CPC Coding Probability

0.0387614

PhyloCSF Frame 2 

-2.952

CNTI Index

noncoding

Max Probability

0.8669

PhyloCSF Frame 3

-4.185

CNTI Score

-0.344031656