McDonnell Genome Institute

Washington University

Transcript

lnc-RAD21-2:1

Chromosome

chr8

Gene Name

lnc-RAD21-2

Start

117004840

CPC Label

noncoding

End

117007639

Cancer

HCC

Strand

-

Peptide

SLSSPASK

Modified Peptide

n[230]SLSSPASK

Peptide Length

8

ORF Length

39

Open Reading Frame (ORF)

LAEGILKSLSSPASKQKSRMLVTKGQFSNSKISVYIFPK

Conservation Score

0.418

PhyloCSF Frame 1

-5.445

No. of Spectra

24

CPC Coding Probability

0.0303114

PhyloCSF Frame 2 

-5.77

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

-5.104

CNTI Score

-0.427555868