McDonnell Genome Institute

Washington University

Transcript

lnc-RAD17-2:1

Chromosome

chr5

Gene Name

lnc-RAD17-2

Start

69349935

CPC Label

noncoding

End

69350445

Cancer

LUAD

Strand

+

Peptide

EAEEFWYR

Modified Peptide

n[230]EAEEFWYR

Peptide Length

8

ORF Length

54

Open Reading Frame (ORF)

MVYFACLMRAWFEEHRKKKKGMMEATPLLREAEEFWYRQHSQPFSSLTLWGYFL

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0781322

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9996

PhyloCSF Frame 3

0

CNTI Score

-0.358457469