McDonnell Genome Institute

Washington University

Transcript

lnc-RACK1-2:2

Chromosome

chr5

Gene Name

lnc-RACK1-2

Start

181245875

CPC Label

noncoding

End

181252438

Cancer

EOGC

Strand

-

Peptide

ELMSLEEER

Modified Peptide

n[145]ELMSLEEER

Peptide Length

9

ORF Length

74

Open Reading Frame (ORF)

LGRDVMGLPGRTMCVLCGRELMSLEEERRPSLATNTRVWDTPEEATRILQGDSKDFAHHLKVRKVRGKASCTEF

Conservation Score

0.915

PhyloCSF Frame 1

0

No. of Spectra

119

CPC Coding Probability

0.244635

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

0

CNTI Score

-0.313259011