McDonnell Genome Institute

Washington University

Transcript

lnc-RACGAP1-3:1

Chromosome

chr12

Gene Name

lnc-RACGAP1-3

Start

49963915

CPC Label

noncoding

End

49968333

Cancer

OSCC

Strand

-

Peptide

ALVLGSPGTLWRSWWRMWDDK

Modified Peptide

n[145]ALVLGSPGTLWRSWWRM[147]WDDK

Peptide Length

21

ORF Length

64

Open Reading Frame (ORF)

LLARAGTCSPAPPARGRALVLGSPGTLWRSWWRMWDDKEERQWARVSQGTLRRDRGGTGQTHGP

Conservation Score

1

PhyloCSF Frame 1

-2.447

No. of Spectra

3

CPC Coding Probability

0.354904

PhyloCSF Frame 2 

-1.604

CNTI Index

noncoding

Max Probability

0.9332

PhyloCSF Frame 3

-2.001

CNTI Score

-0.290944888