McDonnell Genome Institute

Washington University

Transcript

lnc-RACGAP1-1:2

Chromosome

chr12

Gene Name

lnc-RACGAP1-1

Start

49951967

CPC Label

noncoding

End

49962922

Cancer

HCC

Strand

-

Peptide

RAVAELGTEKR

Modified Peptide

n[230]RAVAELGTEKR

Peptide Length

11

ORF Length

110

Open Reading Frame (ORF)

LEPMAMTYPKEVAQGHREAYGESRGARVLSAALIGGGEDAEHQLQCQEELHSHRLASRRAVAELGTEKRRMRKGHLCREGGAHRDCAGLIKDIRTLVQWLKDGKGRELPE

Conservation Score

1

PhyloCSF Frame 1

-3.351

No. of Spectra

1

CPC Coding Probability

0.109187

PhyloCSF Frame 2 

-4.749

CNTI Index

noncoding

Max Probability

0.9992

PhyloCSF Frame 3

15

CNTI Score

-0.287890901