McDonnell Genome Institute

Washington University

Transcript

lnc-RABL2B-3:1

Chromosome

chr22

Gene Name

lnc-RABL2B-3

Start

50754674

CPC Label

noncoding

End

50755434

Cancer

BRCA-Luminal B

Strand

-

Peptide

ANGVHSLQR

Modified Peptide

n[145]ANGVHSLQR

Peptide Length

9

ORF Length

114

Open Reading Frame (ORF)

LPCLTELILTNNRLVELGDLDPLASLKSLTYLSILRNPVTNKKHYRLYVIYKVPQIRVLDFQKVKLKSVRKQRKCSRANGVHSLQRILPGEAKLLIQVLVCQLTKRKVGHLQGM

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.0800522

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9591

PhyloCSF Frame 3

0

CNTI Score

-0.289566767