McDonnell Genome Institute

Washington University

Transcript

lnc-RABL2A-5:3

Chromosome

chr2

Gene Name

lnc-RABL2A-5

Start

113696378

CPC Label

noncoding

End

113699728

Cancer

OV

Strand

+

Peptide

KQSITNVVEDVEK

Modified Peptide

n[145]KQSITNVVEDVEK

Peptide Length

13

ORF Length

100

Open Reading Frame (ORF)

LYENKKAPKKQSITNVVEDVEKLRHSYIAGGKEKWCSHCRTAGQFLKTLNTELPFDPAILLPGIYPGEIKTCPHKNLNTNIRSSTIHNSQKVETTRTPNN

Conservation Score

0.139

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.0236453

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.3879

PhyloCSF Frame 3

0

CNTI Score

-0.397900508