McDonnell Genome Institute

Washington University

Transcript

lnc-RABEP2-7:1

Chromosome

chr16

Gene Name

lnc-RABEP2-7

Start

29130548

CPC Label

noncoding

End

29133887

Cancer

OV

Strand

-

Peptide

VGGGGVVGADSAR

Modified Peptide

n[145]VGGGGVVGADSAR

Peptide Length

13

ORF Length

62

Open Reading Frame (ORF)

MSEHSGACLMWRVGGGGVVGADSARRWPGAQAAPQLRLRQAAGSLVRVDVPMALKDAPQNTD

Conservation Score

0.06

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.163902

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9918

PhyloCSF Frame 3

0

CNTI Score

-0.290171575