McDonnell Genome Institute

Washington University

Transcript

lnc-RABEP2-6:1

Chromosome

chr16

Gene Name

lnc-RABEP2-6

Start

29119373

CPC Label

noncoding

End

29128292

Cancer

BRCA-Luminal B

Strand

-

Peptide

AVLLLPR

Modified Peptide

n[145]AVLLLPR

Peptide Length

7

ORF Length

37

Open Reading Frame (ORF)

LITDLRWGSAQEASGGRAVLLLPRRAELAHRRCFTGD

Conservation Score

0.027

PhyloCSF Frame 1

0

No. of Spectra

4

CPC Coding Probability

0.0217844

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9999

PhyloCSF Frame 3

0

CNTI Score

-0.364039634