McDonnell Genome Institute

Washington University

Transcript

lnc-RAB6C-8:1

Chromosome

chr2

Gene Name

lnc-RAB6C-8

Start

129496296

CPC Label

noncoding

End

129496788

Cancer

BRCA-Basal-like

Strand

+

Peptide

EGMNIVEAT

Modified Peptide

n[145]EGM[147]NIVEAT

Peptide Length

9

ORF Length

45

Open Reading Frame (ORF)

LSMANAGPSTNGSQFFICTAKSEWLDGKQVVFGKMKEGMNIVEAT

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

2

CPC Coding Probability

0.0233562

PhyloCSF Frame 2 

0

CNTI Index

coding

Max Probability

0.9398

PhyloCSF Frame 3

0

CNTI Score

0.658967919