McDonnell Genome Institute

Washington University

Transcript

lnc-RAB6C-6:1

Chromosome

chr2

Gene Name

lnc-RAB6C-6

Start

130006199

CPC Label

coding

End

130009123

Cancer

EOGC

Strand

+

Peptide

ISNLNVLIMLK

Modified Peptide

n[145]ISNLNVLIM[147]LK

Peptide Length

11

ORF Length

86

Open Reading Frame (ORF)

MGLPTLEFSDSYLDSPDFRERLQCQEIELERTNKFIKELIKEGSPLTGALGICLWQCRNFPSHYKISNLNVLIMLKQMMKLVLLSH

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.996919

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5042

PhyloCSF Frame 3

0

CNTI Score

-0.321545887