McDonnell Genome Institute

Washington University

Transcript

lnc-RAB40B-1:4

Chromosome

chr17

Gene Name

lnc-RAB40B-1

Start

82704136

CPC Label

noncoding

End

82705337

Cancer

OV

Strand

-

Peptide

LHGGAGVAWSIPETHR

Modified Peptide

n[145]LHGGAGVAWSIPETHR

Peptide Length

16

ORF Length

127

Open Reading Frame (ORF)

LCAPRLIHWNSTCKVIVFEDGDFGLPSLDSAAADQSCILTVPDPHLQGQMAHGNENDGATSSRVPPTQDQLRPIPMHSAPCLAPRGGRWFIKRLHGGAGVAWSIPETHRLVSSAKQLRRADVGCALT

Conservation Score

0.041

PhyloCSF Frame 1

0

No. of Spectra

90

CPC Coding Probability

0.192922

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9695

PhyloCSF Frame 3

0

CNTI Score

-0.37312847