McDonnell Genome Institute

Washington University

Transcript

lnc-RAB40AL-2:1

Chromosome

chrX

Gene Name

lnc-RAB40AL-2

Start

103007460

CPC Label

noncoding

End

103008072

Cancer

CCRC

Strand

+

Peptide

LGAALLEHSSSR

Modified Peptide

n[230]LGAALLEHSSSR

Peptide Length

12

ORF Length

64

Open Reading Frame (ORF)

LGAALLEHSSSRHFDTAFFLCCLREPLAIYSNLAKVVGCQWSSPSAATESFMPEEIWHPHSFMK

Conservation Score

1

PhyloCSF Frame 1

0

No. of Spectra

3

CPC Coding Probability

0.273146

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.5858

PhyloCSF Frame 3

0

CNTI Score

-0.354404195