McDonnell Genome Institute

Washington University

Transcript

lnc-RAB3C-4:1

Chromosome

chr5

Gene Name

lnc-RAB3C-4

Start

58893058

CPC Label

noncoding

End

58895149

Cancer

GBM

Strand

+

Peptide

NGALGMGLYGK

Modified Peptide

n[230]NGALGM[147]GLYGK

Peptide Length

11

ORF Length

52

Open Reading Frame (ORF)

LAFIQSLVLLTIFPRHWLNLLLIFISIHMALPQLQTKRNGALGMGLYGKLEK

Conservation Score

0.284

PhyloCSF Frame 1

-5.031

No. of Spectra

11

CPC Coding Probability

0.0324466

PhyloCSF Frame 2 

-5.605

CNTI Index

noncoding

Max Probability

0.9827

PhyloCSF Frame 3

-4.349

CNTI Score

-0.356819061