McDonnell Genome Institute

Washington University

Transcript

lnc-RAB3B-1:1

Chromosome

chr1

Gene Name

lnc-RAB3B-1

Start

51856525

CPC Label

noncoding

End

51860389

Cancer

OV

Strand

-

Peptide

LSPIHLSSAPR

Modified Peptide

n[145]LSPIHLSSAPR

Peptide Length

11

ORF Length

62

Open Reading Frame (ORF)

MLGVSGLMGRPQETEFLRLSPIHLSSAPRQDPIIFPAFLIGSYKTLLRGRPTLSLEEGMLIF

Conservation Score

0.79

PhyloCSF Frame 1

0

No. of Spectra

1

CPC Coding Probability

0.132017

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.504

PhyloCSF Frame 3

0

CNTI Score

-0.382772389