McDonnell Genome Institute

Washington University

Transcript

lnc-RAB33B-4:2

Chromosome

chr4

Gene Name

lnc-RAB33B-4

Start

139556610

CPC Label

noncoding

End

139559964

Cancer

OV

Strand

+

Peptide

TMLGTLAPHTSR

Modified Peptide

n[145]TMLGTLAPHTSR

Peptide Length

12

ORF Length

103

Open Reading Frame (ORF)

LSSIAGLFLKVSFSSMKKRTMLGTLAPHTSRNFSPFDCFRKGRVLDQKLGDLSPGAAHLQRCLGSPASQPEFLQIRGLVYIDIRSLGLRLEHSEVLWLKQDTL

Conservation Score

0.587

PhyloCSF Frame 1

-3.986

No. of Spectra

1

CPC Coding Probability

0.0792234

PhyloCSF Frame 2 

-3.159

CNTI Index

coding

Max Probability

0.8657

PhyloCSF Frame 3

-4.511

CNTI Score

0.661090987