McDonnell Genome Institute

Washington University

Transcript

lnc-RAB30-2:1

Chromosome

chr11

Gene Name

lnc-RAB30-2

Start

83094650

CPC Label

noncoding

End

83097284

Cancer

OSCC

Strand

-

Peptide

GIQDNSLK

Modified Peptide

n[145]GIQDNSLK

Peptide Length

8

ORF Length

40

Open Reading Frame (ORF)

LEVLLLRLLISKVECAHSRGIQDNSLKCGKNFHSFYLGLS

Conservation Score

0.13

PhyloCSF Frame 1

-4.889

No. of Spectra

38

CPC Coding Probability

0.0195586

PhyloCSF Frame 2 

-6.005

CNTI Index

noncoding

Max Probability

0.9986

PhyloCSF Frame 3

-5.901

CNTI Score

-0.4159243