McDonnell Genome Institute

Washington University

Transcript

lnc-RAB2A-3:2

Chromosome

chr8

Gene Name

lnc-RAB2A-3

Start

59601403

CPC Label

noncoding

End

59613775

Cancer

EOGC

Strand

+

Peptide

QLYVAAAAAAAAK

Modified Peptide

n[145]QLYVAAAAAAAAK

Peptide Length

13

ORF Length

34

Open Reading Frame (ORF)

LTVSVAWRQLYVAAAAAAAAKVNRSRSLSSKSSQ

Conservation Score

0.293

PhyloCSF Frame 1

-5.83

No. of Spectra

9

CPC Coding Probability

0.0138137

PhyloCSF Frame 2 

-5.51

CNTI Index

noncoding

Max Probability

0.9642

PhyloCSF Frame 3

0

CNTI Score

-0.345724299