McDonnell Genome Institute

Washington University

Transcript

lnc-RAB27B-11:4

Chromosome

chr18

Gene Name

lnc-RAB27B-11

Start

55781319

CPC Label

noncoding

End

55792738

Cancer

OV

Strand

+

Peptide

GTNSLLLK

Modified Peptide

n[145]GTNSLLLK

Peptide Length

8

ORF Length

76

Open Reading Frame (ORF)

LETEKGTNSLLLKQKQKQKKSIPLINVENQRPKTPLCQIPPMTLHCDSNWSVLENAGSNCKEAESANIIMVLSPPK

Conservation Score

0.679

PhyloCSF Frame 1

0

No. of Spectra

35

CPC Coding Probability

0.0278255

PhyloCSF Frame 2 

0

CNTI Index

noncoding

Max Probability

0.9979

PhyloCSF Frame 3

0

CNTI Score

-0.453896305